Computer Science
Subforums
3276 topics in this forum
-
Recently on Google Chrome a .cab file attempted to download itself, which I researched and it was, as assumed, malicious. I did not open it because luckily I know better. It was a real nasty one from what I read too (although I can't remember its name now, it was 3 weeks back). Just today I searched Facebook into Google, clicked the top link, as per usual with the normal URL i.e. 'www.facebook.com' appeared. When I clicked the link Facebook appeared to show up as normal, but Google Chrome opened up its red security warning page and said it was not Facebook, it was actually *name of hidden site URL* trying to collect my username + password. You'll have to bare with me …
-
0
Reputation Points
- 1 reply
- 1.2k views
- 1 follower
-
-
I want to grow in technical field. I want to do some research in parallel computing or some other field of cse. But I need guide for that. Also I wants to do some useful research which will have great impact on the world. Alone I am not able to do it. So can I enroll in some sort of courses? I wants to continue with job also as I don't have more money to spend on further studies. Any suggestions regarding some tests/interviews/research jobs/scholarships other than GRE?
-
0
Reputation Points
- 3 replies
- 1.5k views
- 1 follower
-
-
Hi Gurus, For an algorithm to experience Belady's anomaly, a page that will be referenced in future needs to necessarily evicted. I understand that MRU as its name stands, removes pages that are needed the most, totally opposite to the idea of locality of reference. Although there are certain instances where it does better than others ( for example in case of a loop). Is it true that MRU can suffer Belady's Anomaly in any unfavorable cases? I have searched for an answer to this query for a day long, but found no explicit answer to this. I believe someone from the Science Forum, can surely help me understand this. Thanks, Aniruddha India
-
0
Reputation Points
- 1 reply
- 1.6k views
- 1 follower
-
-
First of all I am a huge Battlestar Galactica fan, so I watched Caprica. I was disappointed, but the program that made the original Cylons made me think. Would it be possible to to create a Digital Double of a person using personality tests, and a lifetime's worth of journal entries?
-
0
Reputation Points
- 7 replies
- 2.1k views
- 2 followers
-
-
Hello, I have an offer from university to study Computer Science. I like it a lot but sometimes I struggle horribly too and get very frustrated. Sometimes even shut the laptop and get away from problems... However, there is another thing: I lack practice and knowledge horribly because I did not have any IT classes available in my town's school and got an insight into programming only recently. What make me sad is that I know very little: usually people who study CS are already knowledgeable and has a lot of experience in advance before starting a degree. The course structure is here: http://www.sheffield.ac.uk/prospectus/courseDetails.do?id=4839362012 -----…
-
0
Reputation Points
- 1 reply
- 1.6k views
-
-
Hi guys, i'm trying to make the basic expectimax and star1 algorithm parallel. What part should I start doing the parallel process. thanks
-
0
Reputation Points
- 1 reply
- 1.5k views
-
-
Hello all, I was wondering what software would you need to create your own program for a clothing store? Something you would use at the front disk to check the price, how many pieces left, how many sold. Just curious and would like to know. I know back in school before I switched my major I took a class about Visual studio and we have done hotel room reservation. Would that be the same? Thanks Tima
-
0
Reputation Points
- 1 reply
- 2.1k views
- 1 follower
-
-
Is the creation of an A.I really possible. I mean can we really write an algorithm to define life? Even the self evolving algorithms lead to nothing more than a new database of what to say when or what to avoid when. What is it that we're missing? any ideas are welcomed. Put forward your theory on how it can be created.
-
0
Reputation Points
- 4 replies
- 2.2k views
- 2 followers
-
-
Hi. I was reading the book Ready Player One, and the idea of Aech's "Basement" Chat room sounded pretty cool to me. I got thinking, and decided I wanted to make a simple one for myself. A (comparitively) simple program, in first person, where I could boot the application, go into the basement, and mess around. Hopefully, I would be able to embed some emulators in it, so I could play Atari, Commodore 64, NES, MAME, and other things, as well as listen to music, and a fwe other things. This would not be available to the public; only to me and my friends that I give a copy to. Come to think of it, it could be top down, since it would be much easier, and would kind of work the…
-
0
Reputation Points
- 0 replies
- 1.2k views
- 1 follower
-
-
I am pursuing mtech in computer science and engineering.As part of the course we need to find ieee/ACM or international journal papers for seminar. And i need to improve that paper and create an implementation based on that paper. I am particularly interested in - data compression - topics.
-
0
Reputation Points
- 0 replies
- 966 views
-
-
Hello everybody. There are so-called camera lens detectors. Link for reference: (the example of camera lens detector) The question is this: is it possible to construct a smart and intelligent hidden camera (with the respective hardware and software means) which will be able to detect such detectors, recognize theirs presence and automatically mask lens system, effectively preventing its detection? You see, a friend of mine wants to buy such thing to use for example in hotels, but I believe that such purchase is unnecessary. Any ideas? Thanks for your time!
-
0
Reputation Points
- 9 replies
- 13.5k views
- 2 followers
-
-
These are some things that can be done in organizing open source crew: (link removed by moderator)
-
0
Reputation Points
- 1 reply
- 1.1k views
- 1 follower
-
-
Hi all, I'm having a bit of trouble understanding how to construct binary syntax trees given a regular expression. Specifically, using the steps of the Thompson construction. Any advice or direction to a website that maybe gives a simple example? The regular expression is: a + ba* Much appreciated, Ray
-
0
Reputation Points
- 1 reply
- 1.5k views
-
-
The largest repository of networking methods, techniques, models and management. Is there a place like that? Well yes there is. The next question then is Where ca we find it? The answer is all around. It's everywhere, in every place by every person you may know or may not ever know. How would I be able to gain access to such resources? Well there are a lot of ways like conferences, seminars and conventions. To name one and is my personal favorite is "The International Conference in Computing, Networking and Digital Technologies" Cause in this conference, we can assure that resources are of highest quality considering the fact that participants of this conference who w…
-
0
Reputation Points
- 0 replies
- 2.3k views
-
-
Memento A = { E.n } where E is an event and n is the last number in the sequence. Through out the movie each scene expands on E.n The original length of the scene is E.n-1 but the point it is trying to get across is E.n-1+E.n By the end of the movie the length of the last scene is E.1 +E.2...E.n. Another funny thing i realized is that the main actor in memento acts like a computer. He recieves an input and displays an out. The input is the text on his pictures and the output is the action that he performs. His day will contain trying to achieve that event. His accepting inputs and displaying outputs. so we have A = {E.n-i} where n-i is the scene number and at t…
-
0
Reputation Points
- 1 reply
- 1.3k views
-
-
Image processing Artifical Intelligent
-
0
Reputation Points
- 3 replies
- 2k views
-
-
Hello, I am start working with graph matching. I need suggestions for good books and algorithms, in the topic graph matching, can someone help-me? My problem can be statement as following: There is two attributed graphs Gm=(Vm,Em) and Gd=(Vd,Ed) that should be merged. Each node vi in Vm contains 3 atributes, number of edges (in and out), area and color. Each node vi in Vd contains 3 atributes, number of edges (in and out), area and name. This should be formulated with an inexact graph matching problem with option for multiples nodes in Gm could be associated to one node in Vd. I am trying to formulate the fitness functions, but i need examples to do …
-
0
Reputation Points
- 1 reply
- 2k views
- 1 follower
-
-
Do you have to create a mathematical base for it separately? Or is that handled by machine code? And is machine code a type of "pre-language" that enables a computer to interact with ("understand") a higher level language? In other words, does each new language have to teach a computer about general math and how to perform every type of basic calculation, or does the language assume the computer is outfitted with such capabilities, and the language only specifies in what order to perform calculations and how to react when text or any other kinds of input occur? Also, is there a variety of machine code languages, the way there is a huge variety of higher lev…
-
0
Reputation Points
- 11 replies
- 3.9k views
- 1 follower
-
-
So I was looking through my computer using the Start button's search bar, for a windows 'reminder' application. Apparently one doesn't exist. But I did find something else... something pretty weird: a doc. file called 'reminder'; when opened there is some text, written in the symbol font- so I can't understand it. Any idea how I can translate or decrypt this seemingly hidden message?
-
0
Reputation Points
- 7 replies
- 2.2k views
- 1 follower
-
-
I used bioruby program before. But it has some problem. What is the matter? It dose not work well. I do not know the cause of the trouble. ruby program [quit] require 'rubygems' require 'bio' #if __FILE__ == $0 begin require 'pp' alias p pp rescue LoadError end puts ">>> Bio::DDBJ::XML::Blast" serv = Bio::DDBJ::XML::Blast.new # serv.log = STDERR query = "MSSRIARALALVVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQL" puts "### searchSimple('blastp', 'SWISS', query)" puts serv.searchSimple('blastp', 'SWISS', query) execution result >>> Bio::DDBJ::XML::Blast /usr/lib/ruby/1.8/net/http.rb:56…
-
0
Reputation Points
- 5 replies
- 2.1k views
-
-
Hai, Do anyone know about LLVM compiler? Can you please help me to find the basic ideas to start with LLVM? Where could I find new project topic in LLVM?
-
0
Reputation Points
- 0 replies
- 828 views
-
-
hi, can I find code in matlab of agglomerative clustering method? thanks
-
0
Reputation Points
- 0 replies
- 1k views
-
-
Suppose one fine day in future, people gather up to form a perfect working group. What characteristics would that group have? Would it have strong or weak hierarchy, would it be faced to promote relaxed working environment or would it be faced to encourage members to work hard and to expose their best to outer world, would it be seamless across all segments or would it allow deviations in particular areas, would it accept new members, what rights would members have, how would it compare to today's most popular firm organizations, how important money would be, ... and stuff like that? I'm really curious about Ur opinions :|
-
0
Reputation Points
- 6 replies
- 2.7k views
- 1 follower
-
-
hi, is the score of sequence alignmnet can be negative when alignmnet non biological sequence? Note: whether global or local alignmnet thanks in advance
-
0
Reputation Points
- 3 replies
- 1.4k views
-
-
Allow me to explain as contritely as possible. This all began about four years ago. I built my own pc, I purchased two different versions of windows xp from a local pc store. One xp pro 32 the other windows xp 64 bit. My first ISP was verizon at the time. This is right after they laid the new fiber optic cables. My router began being flooded with massive amounts of data and contacting ip addresses world wide, even when the pc was not in any use at all. I began a carefully calculated lock down of remote ports and exploit ports. When I finally had the problem defeated within a few min my router was destroyed internally so I had to get a new one from verizon. …
-
0
Reputation Points
- 21 replies
- 4.5k views
- 3 followers
-