Homework Help
For assistance with (but not answers to) homework problems.
A simple reminder to all: this is the "Homework Help" forum, not the "Homework Answers" forum. We will not do your work for you, only point you in the right direction. Posts that do give the answers may be removed.
5186 topics in this forum
-
I need insulators for a thermos that is able to keep water Warmer than 25 c for three hours in a fridge. Any ideas?
-
0
Reputation Points
- 14 replies
- 2.1k views
- 3 followers
-
-
This is not homework but i would like a question answered... In a building technology class a discussion about doors started. It started out with a particular style of door but later progressed to a style of architecture and art. The rest of my class complained that i was straying from the topic, that the topic is doors and the only thing relevant was an actual door. I believe that architecture, history and art are connected and can not be separated. Am I right or wrong? How important is history to architecture?
-
0
Reputation Points
- 0 replies
- 836 views
-
-
Hi!!! I hope you can help me solve the following exercise... If we know: , are these initial values enough for an initial value problem at with unique solution??? Thanks in advance!!!
-
0
Reputation Points
- 0 replies
- 700 views
-
-
I'm looking for some suggestions about enzymatic cascades to do a research work. I'm interested in embryogenesis, organogenesis and I would be grateful if you could suggest me some signal transduction cascade with components like Mitogen-activated protein kinases for example (I like them!). Any pathway that you think its physiological function is interesting would be perfect for me, even if it doesn't have connection with the topics I mentioned before. Thank you very much, Victor
-
0
Reputation Points
- 3 replies
- 894 views
-
-
Hi What is the difference between genotype-phenotype correlation & variable expressivity in genetics? What is the definition of each? What is the difference between them? What is the relationship they have with each other? These questions are confusing for me, Please help me find the answers to these questions.
-
0
Reputation Points
- 3 replies
- 2.4k views
-
-
I need to make a video for sciece showing examples of Newtons 3 laws. What are some easy ways I could demonstrate each law for a video. Thanks
-
0
Reputation Points
- 1 reply
- 873 views
-
-
Footballs P and Q of the same mass rebound from a wall and from the ground respectively (Fig e and f). If their time of impact are equal, which of them experiences a larger force acted by the wall/ground? Give the reasons. sorry for the small pic.
-
0
Reputation Points
- 3 replies
- 1.2k views
- 1 follower
-
-
Just a simple question. When Balancing redox reactions and there are charges on both sides, do they add directly? I have.. Mno4- + Cl- -> Mn2+ + Cl2 Balanced Mn to have 9e- when adding charges directly on both sides of the equation but I don't think that it makes sense. I have an example in my notes where two -'s on either side of an equation balances to create a 2e-. Thank you ? tbz709
-
0
Reputation Points
- 2 replies
- 1.2k views
-
-
Simple C program language question, Do and Do/ while?
-
0
Reputation Points
- 1 reply
- 715 views
-
-
I'm doing predicate logic models and can't seem to get the right answers to any of these problems. here is the question: " test the following formulas in two-element domains, using any technique you wish. Which are true in each model? which are false in some? For those that have counter-examples, present a counterexample as a table of values for F and G." help with any of the following would be amazing: 2. (Ax)(Fx>(Gx v ~Gx)) 3. (Ex) Fx v (Ex) ~Fx I tried to prove that they were tautologies by making a tree for their negand, but all of the branches always remained open since in one branch there never were two formulaes that had the same variables. S…
-
0
Reputation Points
- 2 replies
- 1.2k views
-
-
here is this question in my text book that is as follows: "when P(z) is divided by z2-3z+2 the remainder is 4z-7. Find the remainder when P(z) is divided by: a) z-1 b) z-2" It does not tell me what P(z) is and the example does not explain this kind of question and they are all like this. I am very confused and would really like some help!!
-
0
Reputation Points
- 2 replies
- 1.5k views
- 1 follower
-
-
Hi! I'm new and i need a bit of help........ I had a question where you needed to find the weight of an object without the use of a scale... Materials given were: the object you were finding for, standard weight, meter rule and fulcrum. I thought the best solution would be to make a lever and use the law of moments. I was wondering, what would be some of the limitations of such an experiment. It was an at home experiment. Could this experiment be improved? Is there any advantages to doing such an experiment in a lab?
-
0
Reputation Points
- 2 replies
- 1k views
-
-
A small bead of mass m is threaded on to a smoth circular wire of radius r and centre O fixed in the vertical plane.Bead is projected with speed u from its highest point, A, of the wire.Find the reaction on the bead due to the wire when at P,in terms of m,g,r,u and ₩;where ₩ is the acute angle AOP.
-
0
Reputation Points
- 4 replies
- 1.5k views
- 2 followers
-
-
Consider the following protein sequence. Circle the regions of the protein that you think will either be an internal part of a protein, or found as a transmembrane domain. MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK QTKRMLDMKVNPIQGLASKWDYEKNEWKK I have no idea how to do this. I did a google search, and I found something that said the internal parts of a protein are more likely to be hydrophobic. I went through and found all the hydrophobic amino acids. For the most part, it seemed like hydrophobic were distributed randomly throughout the sequence, except for one pa…
-
0
Reputation Points
- 3 replies
- 1.4k views
-
-
1)What is the output of this code fragment ? i=1; while (i<128) { printf ("%d,i) ; i *=2; } 2) What is the output of this code fragment? i=9384; do { printf ("%d",i ); i /=10; } while (i>0) ; 3)Same question for (i =5,j=i-1;i>0,j>0;--i,j=i-1) printf ("d",i); 4)Same question for (i=10;i>=1,i /=2) printf("%d",i++)
-
0
Reputation Points
- 1 reply
- 882 views
-
-
Hello, I have to design a datapath for an ARM base processor. Like ARM it works conditionally that is if the condition is satisfied the instruction will take place. Otherwise nothing will happen. I have a problem with implementing this nothing into the datapath and control units. Can anyone help me?
-
0
Reputation Points
- 0 replies
- 1.1k views
- 1 follower
-
-
Hey people. I have been fiddling around with PSPICE cadance student version for the past 3 hours trying to get it to simulate a transient response. I will attach a graph of what we got using an oscillioscope in the labs. With PSPICE I just cannot replicate the graph no matter what I do. Its my first time really using the program so I am relatively new to it. If anyone could help I would appreciate it a lot. This is the circuit we need to analyse and the graph we are supposed to get: If anyone could help me understand how to replicate this in PSPICE I will be very greatful. The frequency used on the oscilloscope was 1kHz.
-
0
Reputation Points
- 1 reply
- 1.2k views
-
-
Two rods of different materials with coefficients of linear expansion α1 and α2 respectively; Young's moduli Y1 & Y2 respectively; of initial lengths l1 and l2 respectively are joined at one end. the free ends are fixed to two vertical walls as shown in the fig. Temperature of the surrounding is then increased by T°C. Find out the displacement of the joint of the rods. My work Since my physics is not good so m not pretty sure about what i am applying.. but as i remember my friend guided me once to work on such questions.. I considered the displacement of the joint (say 'x') in any direction (right or left). Now, x = Δl1 - Δl2 and, k1Δl1 = k2Δl2 where, k …
-
0
Reputation Points
- 4 replies
- 1.6k views
-
-
Hello!!! Could anyone help me to solve this exercise? Using Stirling's formula show that( see the first attached file stirling1!!!), where S(x)=-xlnx-(1-x)ln(1-x), 0<=x<=1. I used n!=e^(-n)n^(n+1/2)(2π)^(1/2)*(1+O(1/n)) and my result is (see the second attached file stirling2). Is this equal to the result i have to show?? Thank you!!!!
-
0
Reputation Points
- 0 replies
- 746 views
-
-
I was wondering if anyone in here uses skype and could talk nerdy with me. seriously i am not grasping the material with the teacher i have. however i noticed the more i just talk about what im learning with other people and ask questions (away from my teacher) the more i understand the material. if you are interested in helping me out, add twitch-164 on skype. I really enjoy the stuff im learning but my teacher rambles alot... and now my grade is falling fast.
-
0
Reputation Points
- 2 replies
- 1k views
-
-
(i) how many different poker hands can be dealt to a player? (ii) how many hands include the Ace of spades? (iii) how many hands do not contain include the ace of spades? (iv)how many hands include all 4 aces? (v) how many hands contain exactly 3 aces? so i know that there are 52 cards in a pack and that a poker hand is 5 cards, so the answer to (i) is 52 choose 5 52C5 , using the calculator i get 2598960. and i know that there is only one ace of spades in a pack of cards but i'm not quite sure how to work out part (ii) and if i knew the answer to this then obviously i could work out the answer to part (iii) could anyone give me a bit of help please? …
-
0
Reputation Points
- 6 replies
- 2.5k views
-
-
Can anyone please help with this homework question. Thank you 1 (a) MIPS is a popular metric for rating the performance of a computer. In this context what does MIPS mean? (1 mark) (b) There are three types of MIPS ratings, namely: (i) Native MIPS (ii) Peak MIPS (iii) Relative MIPS Explain how each type is calculated and what their drawbacks may be. (9 marks) © Another derivation of MIPS used by a RISC research team at Stanford – some of whom went on to found the MIPS Company – was Microprocessor [without] Interlocked Pipeline Stages. This approach traded off simplicity in the hardware with complexity in the compiler and ass…
-
0
Reputation Points
- 0 replies
- 1.4k views
-
-
My question regards bones after death. Are bones that turn to ashes in a casket the same (chemically, physically) as bones that turn to ashes when a body is cremated? I'm asking because, when a body is buried, it is not burned but the bones turn to dust or ashes, and when cremated the body is burned and the bones come out brittle from a cremation chamber and are ground up and called "ashes." I want to know if the remains of the bones in both situations are the same, years later, when they are ashes. Thanks
-
0
Reputation Points
- 22 replies
- 24.4k views
- 1 follower
-
-
Given the corner points of a triangle (x1, y1), (x2, y2), (x3, y3), compute the area. Hint: The area of the triangle with corner points (0, 0), (x1, y1), and (x2, y2) is |x1 · y2 - x2 · y1| / 2. Complete the following code: public class Geometry { /** A method to return the smaller of two integers @param a, the first integer @param b, the second integer @return small, the smaller of the two */ public static double triangleArea(double x1, double y1, double x2, double y2, double x3, double y3) { ... } } What's the answer? Having a tough time.
-
0
Reputation Points
- 2 replies
- 5.5k views
-
-
I need to calculate the effective nuclear charge of Cu2+. The formula that I am using is #protons- (total# e- - valence e-). Cu config is [Ar]3d104s1 Cu2+ config is [Ar]3d9 So the total # of protons is 29. Total # of e- is 27 because we lost 2 due to the ionization. Now would the total number of valence e- be 17 because we are looking at the whole 3rd energy level? So would the answer be 29- (27-17)= 19? Thanks.
-
0
Reputation Points
- 0 replies
- 5.6k views
- 1 follower
-