Homework Help

! Moderator Note Dear students, A simple reminder to all: this is the "Homework Help" forum, not the "Homework Answers" forum. We will not do your work for you, only point you in the right direction. Posts that do give the answers may be removed. Best regards, Scienceforums.net Staff p.s. Yes, this is the same text as at the top of the Homework Help forum.

Hi, I've been pulling my hair out trying to solve this. If we treat it as a series similar to proof by induction it can be simplified. Am I on the right track. But the LHS doesn't appear to factorize and reduce in any easy way! 2017-10-24.pdf

can anyone help with these questions?! woudl really appreciate it , finding them impossible! a linear transformation T: R^6 --> R^6 is known to have characteristic polynomial x^2 (x + 1) (x+5)^3 determine all possibilities for the mimimum polynomial of T Let V be and inner product space over C (complex) with inner product space <,> and let u,v, be vectors from V which are orthogonal to each other . prove that ||au+bV||^2 = |a|^2 ||u||^2 + |b|^2 ||v||^2 for any complex numbers a and b. thank you!!!!

Hi, i i have a few questions on momentum and collisions. 1)in a inelastic collision are both objects moving or can 1 be stationary. 2) In a elastic collision why is kinecetic energy conserved? 3) if kinectic energy is conserved in a elastic collision does it mean that it travels with the same velocity it had prior to the collision? And lucky last, a collision invovling dogems or bumper cars whould be what type of collision. Thanks,

!!!!!!!!!!!!!!!!!!

Don't need you to answer tue problems, just give me a point of where to start, i know i have to apply the Henderson-Hasselbatch equation, but i don't know where to start, any help will be thankfull. 1. To maintain a stable hydroponics is preferable to provide a buffer for irrigation rather than pure water. This is because of the osmotic pressure generated by the presence of salts that allows migration of water into the plant cells. So, you need to prepare a buffer solution of 0.5M phosphates, pH 7. You have NaH2PO4 and Na2HPO4. How many kg of each salt you need to prepare 100L of this buffer? 2. Buffering is essential for growing animal tissues in lab. An abrupt c…

I'm doing an experiment with aluminum wires, and when I put them in saltwater, they starting growing these orangish blobs. Then, in regular water, they looked darker in some parts. In air, obviously nothing happened. Can anyone explain what the heck happened with the wires in saltwater because I'm clueless right now? :confused::confused:

Hi everyone. I'm sure you're all glad I'm back with another chemistry problem giving me problems. You can see below is the attached question. Here is the work I have for it. kb = kw/ka = 1 E-14 / 1.8 E-5 = 5.55 E-10 NaC2H3O2 .151 M HC2H3O2 .082 M C2H3O2- + H2O <--> HC2H3O2 + OH- I .151 .082 0 C -x +x +x E .151-x .082+x x kb = [HC2H3O2][OH-] / [C2H3O2-] 5.55 E-10 = [.082 + x][x] / [.151 - x] Since the kb is so low we can make assumptions and use the 5% rule. 5.55 E-10 = [.082][x] / [.151] x = 1.023 E-9 = [OH-] …

QUESTION: Describe all the protons that are chemically equivalent to each other, and magnetically to each other. Then, give the Pople notation describing the proton spin system(s) in the molecule. Full marks for proper justification http://imgur.com/VXhQl ATTEMPT TO SOLVE THIS: For the methyl that's 'dashed', I know that the 3 protons on it are chemically and magnetically equivalent. For the sake of naming it, I assigned it as A3. However, I forgot 'why' it is that this is the case. Can somebody remind me of the reasoning behind this? For the wedged proton, I figured that it just stood on its own. Since it's the only proton on that carbon, I called it B.…

Homework sucks. I've honestly slaved on the google search and can't find any reliable sources. Anyone have an estimation or educated guess?

Please read here and the answer the following questions if you know: How did the author derive the following equations? pKa = 0.09018 + 2727.92/T f = 1/(10(pKa − pH) + 1) How would you interpret the answers given by 'R' using this package? How is NH3_mgL computed in 'R' using this package? What is the denomination of total ammonia in the argument given by the author in the examples ? Is it mol/L or in grams?

If cells didn't have a limit to the amount of times they could divide, causing them to die, would we just live forever assuming our health was in good condition?

Hey guys, There are 2 school activities that I'm getting into: 1. build Paper Plane (only A4 paper and stapler) 2. make fancy stuff from a program called Geometer's Sketchpad. for (1), I found these site: http://howto.wired.com/wiki/Fold_Your_Own_Sky_King_Paper_Airplane http://www.paperairplanes.co.uk/planes.php hope anyone can contribute any better site! for (2), can anyone give some tip / idea on what should I do?!

Yesterday was my periodic school test in science, and one of the questions asked: “What type of reaction occurs when fuel or gas burns?” I wrote "combustion reaction" as my answer, but the teacher marked it wrong and said the correct answer is "oxidation reaction." According to NCERT Class 10 Science, the main types of chemical reactions listed are: Combination Decomposition Displacement Double Displacement Oxidation Reduction (and Redox) While combustion isn't listed under the core classification, NCERT Chapter 6 (on combustion and flame) clearly defines combustion as a reaction where a substance combines with oxygen to release heat and light — i.e., exactly what happens…

Do you think Music's effects on plant growth would be an approporiate biology experiment for extended essay (IB) ? I know that have "music" as a variable sounds silly, but how could I set the variables so that the lab can be analysed in depth ?

Just three questions that I want to clarify about the meanings for. Q1: A northern wind (blowing north to south) is blowing at 70m/s. If a jet is flying at 280m/s and the pilot wanted to fly due west, what heading should the plane take? What is the new groundspeed for the plane? Ok, so I Just want to check: this question is asking for what angle the plane should be flying at (somewhere in the NW direction) so that, with the northern wind, it would be going exactly west? And then I find the ground speed too, yes? Q2: Mr. Smith throws a bar at with a speed of 30m/s at an angle from the horizontal that gives maximum range. His student is sitting on a desk loca…

I'm not sure what i'm doing wrong for the following question: "An object is dropped from a tower. If it had been thrown down at 60m/s, it would half taken have the time. What is the height of the tower? (Note that acceleration is 10m/s^2 here)" So the parameters should be: V (initial): 60m/s V (final): 0m/s A: 10 m/s^2 T: 6 s And if I used the equation D = V (initial)*T + 1/2 a(t)^2 and subbed it all in, I ended up with 540m for the height. But the answer is supposed to be 320. Does anyone know what I did wrong?

The average concentrations of bromine in seawater (d=1.024g/mL) and the Dead Sea (d=1.22g/mL) are .065g/L and .50g/L, respectively. What is the mass ratio of bromine in the dead sea to that in seawater? I have no clue what to do here. The answer is 7.7/1 but I can't get there. Is this testing significant figures? EDIT: Wow was I overthinking this. Just divide the two concentrations to get 7.69 which is 7.7..... don't I feel foolish.

where can I find what [Ag(NH3)]2SO4, [Cu(NH3)2]2SO4, and [Ni(NH3)2]2SO4 are used in? I've read a line that they can be used in explosives, but I have not had much success in finding anything else. Ive just been doing the search on google and yahoo, is there a better place to search? Or do you know of reactions I could read on to find out? Thank you for reading, hope you can help.

A processor has 32 bit word instructions.

1. Under normal operating conditions 1.5% of the transistors produced in a factory are defective. An inspector takes a random sample of forty transistors and finds that two are defective. a. What is the probability that exactly two transistors will be defective from a random sample of forty under normal operating conditions? b. What is the probability that more than two transistors will be defective from a random sample of forty if conditions are normal? 2. A control system is set up so that when production conditions are normal, only 6% of items from the production line gives readings beyond a particular limit. If more tha two of six successive items are beyond the…

Hi guys, I was hoping you could give me some tips on how to answer a question on gel electrophoresis. I am examining how 2 lactate dehydrogenase components (muscle & heart component) are travelling through a gel. The question asks how LDH travelling through the gel would be affected by a decrease in the pH. Thanks!

Consider the following protein sequence. Circle the regions of the protein that you think will either be an internal part of a protein, or found as a transmembrane domain. MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK QTKRMLDMKVNPIQGLASKWDYEKNEWKK I have no idea how to do this. I did a google search, and I found something that said the internal parts of a protein are more likely to be hydrophobic. I went through and found all the hydrophobic amino acids. For the most part, it seemed like hydrophobic were distributed randomly throughout the sequence, except for one pa…

How is it flipped in 2nd step ?

xA and xB are mole fractions of each components - Vapour-liquid phase ? why is AI saying it's liquid phase composition ? Henry's Law : p = KH x “partial pressure of as in vapour phase (p) is proportional to ole fraction of gas (x) in solution” and is expressed as: Raoult’s Law: A=xA pA∘ pi = yi P total - this is the ratio of 2 components in vapour phase AI Solved - Given: p°A = 450 mm Hg p°B = 700 mm Hg Total vapour pressure, P = 600 mm Hg Let xA be the mole fraction of A in the liquid phase. Then xB = 1 − xA Using Raoult’s law: P = xA·p°A + xB·p°B 600 = 450xA + 700(1 − xA) 600 = 700 − 250xA xA = 0.40 Therefore: xA = 0.40 xB = 0.60 Partial vapour pressures: pA = x…