Homework Help

Simple C program language question, Do and Do/ while?

I'm doing predicate logic models and can't seem to get the right answers to any of these problems. here is the question: " test the following formulas in two-element domains, using any technique you wish. Which are true in each model? which are false in some? For those that have counter-examples, present a counterexample as a table of values for F and G." help with any of the following would be amazing: 2. (Ax)(Fx>(Gx v ~Gx)) 3. (Ex) Fx v (Ex) ~Fx I tried to prove that they were tautologies by making a tree for their negand, but all of the branches always remained open since in one branch there never were two formulaes that had the same variables. S…

here is this question in my text book that is as follows: "when P(z) is divided by z2-3z+2 the remainder is 4z-7. Find the remainder when P(z) is divided by: a) z-1 b) z-2" It does not tell me what P(z) is and the example does not explain this kind of question and they are all like this. I am very confused and would really like some help!!

Hi! I'm new and i need a bit of help........ I had a question where you needed to find the weight of an object without the use of a scale... Materials given were: the object you were finding for, standard weight, meter rule and fulcrum. I thought the best solution would be to make a lever and use the law of moments. I was wondering, what would be some of the limitations of such an experiment. It was an at home experiment. Could this experiment be improved? Is there any advantages to doing such an experiment in a lab?

A small bead of mass m is threaded on to a smoth circular wire of radius r and centre O fixed in the vertical plane.Bead is projected with speed u from its highest point, A, of the wire.Find the reaction on the bead due to the wire when at P,in terms of m,g,r,u and ￦;where ￦ is the acute angle AOP.

Consider the following protein sequence. Circle the regions of the protein that you think will either be an internal part of a protein, or found as a transmembrane domain. MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK QTKRMLDMKVNPIQGLASKWDYEKNEWKK I have no idea how to do this. I did a google search, and I found something that said the internal parts of a protein are more likely to be hydrophobic. I went through and found all the hydrophobic amino acids. For the most part, it seemed like hydrophobic were distributed randomly throughout the sequence, except for one pa…

1)What is the output of this code fragment ? i=1; while (i<128) { printf ("%d,i) ; i *=2; } 2) What is the output of this code fragment? i=9384; do { printf ("%d",i ); i /=10; } while (i>0) ; 3)Same question for (i =5,j=i-1;i>0,j>0;--i,j=i-1) printf ("d",i); 4)Same question for (i=10;i>=1,i /=2) printf("%d",i++)

Hello, I have to design a datapath for an ARM base processor. Like ARM it works conditionally that is if the condition is satisfied the instruction will take place. Otherwise nothing will happen. I have a problem with implementing this nothing into the datapath and control units. Can anyone help me?

Hey people. I have been fiddling around with PSPICE cadance student version for the past 3 hours trying to get it to simulate a transient response. I will attach a graph of what we got using an oscillioscope in the labs. With PSPICE I just cannot replicate the graph no matter what I do. Its my first time really using the program so I am relatively new to it. If anyone could help I would appreciate it a lot. This is the circuit we need to analyse and the graph we are supposed to get: If anyone could help me understand how to replicate this in PSPICE I will be very greatful. The frequency used on the oscilloscope was 1kHz.

Two rods of different materials with coefficients of linear expansion α1 and α2 respectively; Young's moduli Y1 & Y2 respectively; of initial lengths l1 and l2 respectively are joined at one end. the free ends are fixed to two vertical walls as shown in the fig. Temperature of the surrounding is then increased by T°C. Find out the displacement of the joint of the rods. My work Since my physics is not good so m not pretty sure about what i am applying.. but as i remember my friend guided me once to work on such questions.. I considered the displacement of the joint (say 'x') in any direction (right or left). Now, x = Δl1 - Δl2 and, k1Δl1 = k2Δl2 where, k …

Hello!!! Could anyone help me to solve this exercise? Using Stirling's formula show that( see the first attached file stirling1!!!), where S(x)=-xlnx-(1-x)ln(1-x), 0<=x<=1. I used n!=e^(-n)n^(n+1/2)(2π)^(1/2)*(1+O(1/n)) and my result is (see the second attached file stirling2). Is this equal to the result i have to show?? Thank you!!!!

I was wondering if anyone in here uses skype and could talk nerdy with me. seriously i am not grasping the material with the teacher i have. however i noticed the more i just talk about what im learning with other people and ask questions (away from my teacher) the more i understand the material. if you are interested in helping me out, add twitch-164 on skype. I really enjoy the stuff im learning but my teacher rambles alot... and now my grade is falling fast.

(i) how many different poker hands can be dealt to a player? (ii) how many hands include the Ace of spades? (iii) how many hands do not contain include the ace of spades? (iv)how many hands include all 4 aces? (v) how many hands contain exactly 3 aces? so i know that there are 52 cards in a pack and that a poker hand is 5 cards, so the answer to (i) is 52 choose 5 52C5 , using the calculator i get 2598960. and i know that there is only one ace of spades in a pack of cards but i'm not quite sure how to work out part (ii) and if i knew the answer to this then obviously i could work out the answer to part (iii) could anyone give me a bit of help please? …

Can anyone please help with this homework question. Thank you 1 (a) MIPS is a popular metric for rating the performance of a computer. In this context what does MIPS mean? (1 mark) (b) There are three types of MIPS ratings, namely: (i) Native MIPS (ii) Peak MIPS (iii) Relative MIPS Explain how each type is calculated and what their drawbacks may be. (9 marks) © Another derivation of MIPS used by a RISC research team at Stanford – some of whom went on to found the MIPS Company – was Microprocessor [without] Interlocked Pipeline Stages. This approach traded off simplicity in the hardware with complexity in the compiler and ass…

My question regards bones after death. Are bones that turn to ashes in a casket the same (chemically, physically) as bones that turn to ashes when a body is cremated? I'm asking because, when a body is buried, it is not burned but the bones turn to dust or ashes, and when cremated the body is burned and the bones come out brittle from a cremation chamber and are ground up and called "ashes." I want to know if the remains of the bones in both situations are the same, years later, when they are ashes. Thanks

Given the corner points of a triangle (x1, y1), (x2, y2), (x3, y3), compute the area. Hint: The area of the triangle with corner points (0, 0), (x1, y1), and (x2, y2) is |x1 · y2 - x2 · y1| / 2. Complete the following code: public class Geometry { /** A method to return the smaller of two integers @param a, the first integer @param b, the second integer @return small, the smaller of the two */ public static double triangleArea(double x1, double y1, double x2, double y2, double x3, double y3) { ... } } What's the answer? Having a tough time.

I need to calculate the effective nuclear charge of Cu2+. The formula that I am using is #protons- (total# e- - valence e-). Cu config is [Ar]3d104s1 Cu2+ config is [Ar]3d9 So the total # of protons is 29. Total # of e- is 27 because we lost 2 due to the ionization. Now would the total number of valence e- be 17 because we are looking at the whole 3rd energy level? So would the answer be 29- (27-17)= 19? Thanks.

I have an issue solving this limit: [latex]\lim_{x\to 0}\frac{\; ln\left (1+3x \right )\; }{x}[/latex] The answer is 3, however I'm not sure how it's obtained. I know that [latex]\lim_{x\to 0}\frac{\; ln\left (1+x \right )\; }{x} = 1[/latex] but I can't quite figure out how to implement this property on the problem above. Could someone please give me a step-by-step explanation on how it should be solved? That would be great!

Q:- The resistances of commercially-available discrete resistors are restricted to particular sets. For example, the available values of resistors with 10% tolerance are selections from the E12 set multiplied by a power of ten from 100 through 105. The E12 set is: E12={10,12,15,18,22,27,33,39,47,56,68,82…} Thus, you can buy 10% resistors with a nominal resistance of 330Ω or 33kΩ, but not 350Ω. Furthermore, the "tolerance" means that if you buy a 10% 390Ω resistor you can be sure that its resistance is between 351Ω and 429Ω. In this problem we need to choose 10% resistors to make a current divider that meets a given specification. …

Hi! Can anyone help me find a site(or program) which allows me to create my own game (a simple one)? I tried to google it,but i was lost and i really need to create a simple game to add it to my profile in my optional subject at school. Thanks !

A skateboarder with a total mass of 70 kg starts from rest at the top of a ramp and accelerates down it. The ramp is 25 m long and is at an angle of 200 to the horizontal. The skateboarder has a velocity of 12.2 m s–1 at the bottom of the ramp. (i) Calculate the average acceleration of the skateboarder on the ramp. (ii) Calculate the component of the skateboarder’s weight that is parallel to the ramp. using one of the equations of motion i can get the acceleration to be 2.98 ms-2 but i,m having trouble with the second part , i know that the vertical component (his weight due to gravity) is (70)(9.8) = 686N. can i use trigonometry or something to get the t…

This isn't really homework, but it being basic math I thought Id post here. I have the following problem: say I have two points in a 3d space A & B and want to find a Point C that is on a line between A & B but has a specific length. The coordinates of A & B are given (x,y and z respectively). My brain handles trig fine in 2d, but for some reason I am making some sort of mistake in 3d. thanks a bundle, Mark

Say there is 4 people sharing a house that should pay 25% each of the outgoings. The method I used is as follows for use in a spread sheet. To calculate who owes what and to whom? You can update the spread sheet by adding more expenses also for the pay period Person 1 pays rent $270.00 / fortnight and same person pays $140.00 for Electricity. Person 2 buys food $400.00 / fortnight Person 3 buys food $400.00 / fortnight Person 4 buys some food $100 /fortnight Total Group spend = 1310 In order to calculate the difference percentage in money you take each persons spending and divide by the Total Spent Person 1 = 0.31 eg 31% Person 2 = 0.305 Pe…

Hello, I'm having a bit of difficulty calculating this limit. [latex]\lim_{x\to+\infty }\frac{1}{\; \sqrt{x+1}-\sqrt{x+7}\; }[/latex] [latex]\lim_{x\to+\infty }\frac{1}{\; \sqrt{+\infty +1}-\sqrt{+\infty +7}\; }[/latex] [latex]\lim_{x\to+\infty }\frac{1}{\; \sqrt{+\infty}-\sqrt{+\infty}\; }[/latex] [latex]\lim_{x\to+\infty }\frac{1}{\;+\infty-\infty \; }[/latex] Well this is where I'm stuck. Naturally the square root of infinity will always remain infinity however it results in an indeterminate form since positive infinity cannot be summed with negative infinity. According to my text book the answer should be [latex]-\infty[/latex] but I have no i…

Tooth enamel contains a compound with the formula Ca10(PO4)6(OH2). Why can a child's teeth be damaged over time if the child is put to bed with a bottle of milk? (HINT: Milk can break down over time to produce lactic acid. I was thinking the solution would be like this : Acid + Base = Water + Salt Acid (Lactic acid) : C3H6O3 Base (Tooth enamel compound) C3H6O3 + Ca10(PO4)6(OH2) ----> H2O + ???????? Thanks for your help, I appreciate it!