Jump to content

Active Insulin analysis

adinboy
in Biochemistry and Molecular Biology

Featured Replies

So I have a question about the active form of insulin. I know the 1 letter amino acid sequence for insulin is:

 

GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT

 

I used http://web.expasy.org/compute_pi/ to calculate the theoretical pI of insulin which is around 5.39. The question is what the charge of this insulin would be in a pH solution of 7.4.

 

The exact question is: At pH 7.4, what would be the charge (if any) for insulin? Explain how you came to that conclusion.

 

I know when in a pH solution that is higher than the pI value of the protein then the amino acid will be deprotinated and migrate to the positive side. So would the answer be that it is negatively charge or do I have to come up with an exact number like -2?

 

 

Archived

This topic is now archived and is closed to further replies.

Go to topic listing

Important Information

We have placed cookies on your device to help make this website better. You can adjust your cookie settings, otherwise we'll assume you're okay to continue.

Configure browser push notifications
Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.